PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10040069
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 349aa    MW: 38305.6 Da    PI: 4.7928
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10040069genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.51.9e-10139183448
                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                  +k+ rr  +NR AA rsR+RKk++++ Le k+k Le e ++L   
  Lus10040069 139 SKKRRRQLRNRDAAVRSRERKKMYVKDLEMKSKYLEWECRRLGRL 183
                  6999********************************999876544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.6E-7135200IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.9E-12137198No hitNo description
PROSITE profilePS502179.703138201IPR004827Basic-leucine zipper domain
PfamPF001701.9E-8140191IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.25E-10140196No hitNo description
CDDcd147041.76E-16141192No hitNo description
PROSITE patternPS000360143158IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGQIDWDSFE GLLENGSEVD IFHQGPDAAL SSFPNSVPDS LSCQIEDIEN LLMTEDGPGD  60
LHLDDDFLAQ FLVDSPPTPP ADDSSSPDPD ISHSSLSSRP DSSDKDNARC LAAGSPHPHL  120
AVEDDDDDDD DTAPNDPISK KRRRQLRNRD AAVRSRERKK MYVKDLEMKS KYLEWECRRL  180
GRLLQCCAAE NQALRFSLQS RSGVAAYGAT SARQESAVLL LGLNILVCIG FELTGIGIGI  240
GTSTDIVGVL CVFAESLLLG SLLWFLGIMC LFSLPTVAQL MVPLMEPKGE SRKEGKRSKM  300
ATPHLGEPFL VRGRRCKASR TRMKLTYLYS SCIGVMVEES RAMYCLVK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140159KRRRQLRNRDAAVRSRERKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8299921e-155EU829992.1 Linum usitatissimum clone LU0014G02 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120093032
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.12e-17basic region/leucine zipper motif 60